PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013590799.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 226aa    MW: 26702 Da    PI: 5.4468
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013590799.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.78.7e-162067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll +++   G g+W+++a+  g++R +k+c++rw++yl
   XP_013590799.1 20 RGPWTLEEDTLLTNYILHNGEGRWNLVAKSAGLKRNGKSCRLRWLNYL 67
                     89********************************************97 PP

2Myb_DNA-binding52.41.2e-1673116146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
   XP_013590799.1  73 RGNLTPQEQLLILELHSKWGNR-WSKIAQYLP-GRTDNEIKNYWRT 116
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.0781567IPR017930Myb domain
SuperFamilySSF466892.42E-3017114IPR009057Homeodomain-like
SMARTSM007171.3E-121969IPR001005SANT/Myb domain
PfamPF002492.0E-142067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-212174IPR009057Homeodomain-like
CDDcd001675.13E-82267No hitNo description
PROSITE profilePS5129425.26468122IPR017930Myb domain
SMARTSM007171.4E-1472120IPR001005SANT/Myb domain
PfamPF002491.0E-1573116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-2375121IPR009057Homeodomain-like
CDDcd001671.96E-1077116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MEDSMKTKSF KESEEVGLRR GPWTLEEDTL LTNYILHNGE GRWNLVAKSA GLKRNGKSCR  60
LRWLNYLKPD IRRGNLTPQE QLLILELHSK WGNRWSKIAQ YLPGRTDNEI KNYWRTRVQK  120
QARQLNIESN SDKFFDAVRS FWVPRLIEKM EQNSFTNCCP QNNNNPNTII DGSMCNQELG  180
GYIPEMEEYY YMGNSDIGTE CHVAEAYEDV TQDPMWNMDD IWQFRE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-24181225108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM9756550.0KM975655.1 Brassica napus MYB transcription factor 62.1 (MYB62.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013590799.11e-170PREDICTED: myb-related protein 340-like isoform X2
SwissprotQ9LDE14e-62MY108_ARATH; Transcription factor MYB108
TrEMBLA0A078JPI31e-161A0A078JPI3_BRANA; BnaCnng63810D protein
TrEMBLA0A0D3CXW11e-161A0A0D3CXW1_BRAOL; Uncharacterized protein
STRINGBra004041.1-P1e-157(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.11e-108myb domain protein 62